FOXA1 Recombinant monoclonal antibody, PBS Only

FOXA1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR
Cat No. 85125-6-PBS
Clone No.242658F9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR

242658F9, forkhead box A1, Forkhead box protein A1, Hepatocyte nuclear factor 3-alpha, HNF 3 alpha

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85125-6-PBS targets FOXA1 in WB, IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14243

Product name: Recombinant human FOXA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 267-399 aa of BC033890

Sequence: KCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHP

Predict reactive species
Full Name forkhead box A1
Calculated Molecular Weight 473 aa, 49 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC033890
Gene Symbol FOXA1
Gene ID (NCBI) 3169
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP55317
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Forkhead box A1(FOXA1),also named hepatocyte nuclear factor 3-alpha (HNF-3A), is a transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Binds DNA with the consensus sequence 5'-[AC]A[AT]T[AG]TT[GT][AG][CT]T[CT]-3' (By similarity). Proposed to play a role in translating the epigenetic signatures into cell type-specific enhancer-driven transcriptional programs. Its differential recruitment to chromatin is dependent on distribution of histone H3 methylated at 'Lys-5' (H3K4me2) in estrogen-regulated genes. Involved in the development of multiple endoderm-derived organ systems such as liver, pancreas, lung and prostate; FOXA1 and FOXA2 seem to have at least in part redundant roles (By similarity). Modulates the transcriptional activity of nuclear hormone receptors. Is involved in ESR1-mediated transcription; required for ESR1 binding to the NKX2-1 promoter in breast cancer cells; binds to the RPRM promter and is required for the estrogen-induced repression of RPRM. Involved in regulation of apoptosis by inhibiting the expression of BCL2. Involved in cell cycle regulation by activating expression of CDKN1B, alone or in conjunction with BRCA1. Originally discribed as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis.

Loading...
||
New chat Able
正在加载,请稍候...