FOXC2 Monoclonal antibody

FOXC2 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 68384-1-Ig
Clone No.3E3E1

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Rat, Pig and More (1)

Applications

WB, IF, IHC, ELISA

FKHL14, Forkhead box protein C2, FOXC2, LD, Mesenchyme fork head protein 1, MFH 1, MFH 1 protein, MFH1, Transcription factor FKH 14

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhTERT-RPE1 cells, U-87 MG cells, rat kidney tissue, rat heart tissue, rat adipose tissue, pig adipose tissue
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

68384-1-Ig targets FOXC2 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Rat, Pig samples.

Tested Reactivity Human, Rat, Pig
Cited Reactivityhuman
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19378

Product name: Recombinant human FOXC2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 205-501 aa of BC113437

Sequence: KEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY

Predict reactive species
Full Name forkhead box C2 (MFH-1, mesenchyme forkhead 1)
Calculated Molecular Weight 501 aa, 54 kDa
Observed Molecular Weight56 kDa
GenBank Accession NumberBC113437
Gene Symbol FOXC2
Gene ID (NCBI) 2303
RRIDAB_3085102
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99958
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Forkhead box protein C2 (FOXC2) also known as forkhead-related protein FKHL14 (FKHL14), transcription factor FKH-14, or mesenchyme fork head protein 1 (MFH1) is a protein that in humans is encoded by the FOXC2 gene. FOXC2 is a member of the fork head box (FOX) family of transcription factors. FOX transcription factors are expressed during development and are associated with a number of cellular and developmental differentiation processes. FOXC2 is required during early development of the kidneys, including differentiation of podocytes and maturation of the glomerular basement membrane. It is also involved in the early development of the heart. FOXC2 is also involved in cancer metastases. In particular, expression of FOXC2 is induced when epithelial cells undergo an epithelial-mesenchymal transition (EMT) and become mesenchymal looking cells. (PMID: 8674414 9169153 19935708)

Protocols

Product Specific Protocols
WB protocol for FOXC2 antibody 68384-1-IgDownload protocol
IHC protocol for FOXC2 antibody 68384-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cell Rep

Stabilizing vimentin phosphorylation inhibits stem-like cell properties and metastasis of hybrid epithelial/mesenchymal carcinomas

Authors - Nick A Kuburich
Loading...
||
New chat Able
正在加载,请稍候...