FOXC2 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP00470-4

  Sandwich ELISA standard curve of MP00470-4, Human FOXC2 Recombinant Matched Antibody Pair - PBS only. 83476-7-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag33121. 83476-5-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.

• 

  Sample test of MP00470-4

  The mean FOXC2 concentration was determined to be 2.8 ng/mL in HeLa cell extract based on a 1.5 mg/mL extract load.

• 

  IF Staining of A375 using 83476-5-RR (same clone as 83476-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A375 cells using FOXC2 antibody (83476-5-RR, Clone: 240403H7 ) at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83476-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83476-5-RR (same clone as 83476-5-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug FOXC2 Recombinant antibody (83476-5-RR, Clone:240403H7) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83476-5-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 83476-5-RR (same clone as 83476-5-PBS)

  1x10^6 A549 cells were intracellularly stained with 0.25 ug FOXC2 Recombinant antibody (83476-5-RR, Clone:240403H7) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83476-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83476-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83476-5-RR against Human FOXC2 were performed. The affinity constant is 2.79 nM.

FOXC2 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83476-5-PBS

Clone No.240403H7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

MFH 1, Mesenchyme fork head protein 1, Forkhead-related protein FKHL14, Forkhead box protein C2, FKHL14

---

Product Information

83476-5-PBS targets FOXC2 as part of a matched antibody pair:

MP00470-4: 83476-7-PBS capture and 83476-5-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33121

  Product name: Recombinant human FOXC2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 205-501 aa of NM_005251

  Sequence: KEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY*

• Full Name: forkhead box C2 (MFH-1, mesenchyme forkhead 1)
• Calculated Molecular Weight: 54kd
• GenBank Accession Number: NM_005251
• Gene Symbol: FOXC2
• Gene ID (NCBI): 2303
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q99958
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Forkhead box protein C2 (FOXC2) also known as forkhead-related protein FKHL14 (FKHL14), transcription factor FKH-14, or mesenchyme fork head protein 1 (MFH1) is a protein that in humans is encoded by the FOXC2 gene. FOXC2 is a member of the fork head box (FOX) family of transcription factors. FOX transcription factors are expressed during development and are associated with a number of cellular and developmental differentiation processes. FOXC2 is required during early development of the kidneys, including differentiation of podocytes and maturation of the glomerular basement membrane. It is also involved in the early development of the heart. FOXC2 is also involved in cancer metastases. In particular, expression of FOXC2 is induced when epithelial cells undergo an epithelial-mesenchymal transition (EMT) and become mesenchymal looking cells. (PMID: 8674414 9169153 19935708) This antibody recognizes the 56 kDa FOXC2 protein, but the phosphorylated FOXC2 may be a 56-65 kDa protein. The 62kDa band was also detected in the study(PMID: 19540201).