FOXG1 Polyclonal antibody

FOXG1 Polyclonal Antibody for WB, ELISA
Cat No. 12764-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

BF 1, BF 2, BF1, BF2, Brain factor 1, Brain factor 2, FHKL3, FKH2, FKHL1, FKHL2, FKHL3, FKHL4, forkhead box G1, Forkhead box protein G1, Forkhead box protein G1A, Forkhead box protein G1B, Forkhead box protein G1C, Forkhead related protein FKHL1, Forkhead related protein FKHL2, Forkhead related protein FKHL3, FOXG1, FOXG1A, FOXG1B, FOXG1C, HBF 1, HBF 2, HBF 3, HBF G2, HBF2, HFK1, HFK2, HFK3, KHL2, QIN

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue, mouse brain tissue, SH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12764-1-AP targets FOXG1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3426

Product name: Recombinant human FOXG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 190-489 aa of BC035020

Sequence: IMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPHVPHPSMTSQSSTSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLIH

Predict reactive species
Full Name forkhead box G1
Calculated Molecular Weight 489 aa, 52 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC035020
Gene Symbol FOXG1
Gene ID (NCBI) 2290
RRIDAB_2231894
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP55316
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Forkhead Box G1 (FOXG1) is a member of the Forkhead family of genes with non-redundant roles in brain development, where alteration of this gene's expression significantly affects the formation and function of the mammalian cerebral cortex. FOXG1 haploinsufficiency in humans is associated with prominent differences in brain size and impaired intellectual development noticeable in early childhood, while homozygous mutations are typically fatal.

Protocols

Product Specific Protocols
WB protocol for FOXG1 antibody 12764-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...