FOXJ1 Polyclonal antibody

• 

  WB analysis using 25903-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25903-1-AP (FOXJ1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

FOXJ1 Polyclonal Antibody for WB, ELISA

Cat No. 25903-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

FKHL13, Forkhead-related protein FKHL13, HFH 4, HFH4, HFH-4

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25903-1-AP targets FOXJ1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20827

  Product name: Recombinant human FOXJ1 protein

  Source: e coli.-derived, PET32a

  Tag: 6*His

  Domain: 1-421 aa of BC046460

  Sequence: MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAPALPPGGTDPHGYHQVPGSAAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKGNFDWEAIFDAGTLGGELGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL

• Full Name: forkhead box J1
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC046460
• Gene Symbol: FOXJ1
• Gene ID (NCBI): 2302
• RRID: AB_3669505
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92949
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FOXJ1 (Forkhead box protein J1) acts by activating the transcription of genes mediating motile cilia's assembly, such as CFAP157. It binds the DNA consensus sequences 5'-HWDTGTTTGTTTA-3' or 5'-KTTTGTTGTTKTW-3' (where H is not G, W is A or T, D is not C, and K is G or T), and activates the transcription of a variety of ciliary proteins in the developing brain and lung (PMID: 31630787).