FOXJ1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FOXJ1 Polyclonal antibody (28443-1-AP)

FOXJ1 Polyclonal Antibody for WB, ELISA

Cat No. 28443-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IF, ELISA

Synonyms

FKHL13, forkhead box J1, Forkhead box protein J1, FOXJ1, HFH 4, HFH4

• 

  WB analysis using 28443-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28443-1-AP (FOXJ1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FOXJ1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Caco-2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28443-1-AP targets FOXJ1 in WB, IF, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28294

  Product name: Recombinant human FOXJ1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 181-421 aa of BC046460

  Sequence: KVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKGNFDWEAIFDAGTLGGELGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL

• Full Name: forkhead box J1
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC046460
• Gene Symbol: FOXJ1
• Gene ID (NCBI): 2302
• RRID: AB_2918166
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92949
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The FOXJ1 Polyclonal antibody (Cat# 28443-1-AP) has 2 total citations. These appear in Frontiers in Pharmacology and Clinical Respiratory Journal. The cited research focuses on respiratory and cilia biology, specifically examining lung epithelial cilia assembly in severe respiratory infections and Foxj1 down-expression related to impaired cilia architecture in non-cystic fibrosis bronchiectasis. Both studies used the antibody for immunofluorescence (IF) in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Front Pharmacol; Serum valeric acid stimulates lung epithelial cilia assembly and improves prognosis in patients with severe respiratory infections.; Authors - Yabin Zhang
human	IF	Clin Respir J; Down-expression of Foxj1 on airway epithelium with impaired cilia architecture in non-cystic fibrosis bronchiectasis implies disease severity; Authors - Xiao-Ling Zou