FOXJ1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86070-1-RR (same clone as 86070-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86070-1-RR (FOXJ1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86070-1-PBS in a different storage buffer formulation.

FOXJ1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86070-1-PBS

Clone No.250724E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

FKHL13, Forkhead-related protein FKHL13, HFH 4, HFH4, HFH-4

---

Product Information

86070-1-PBS targets FOXJ1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28294

  Product name: Recombinant human FOXJ1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 181-421 aa of BC046460

  Sequence: KVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKGNFDWEAIFDAGTLGGELGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL

• Full Name: forkhead box J1
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC046460
• Gene Symbol: FOXJ1
• Gene ID (NCBI): 2302
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92949
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.