FOXJ1 Recombinant monoclonal antibody

• 

  WB analysis using 86070-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86070-1-RR (FOXJ1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

FOXJ1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86070-1-RR

Clone No.250724E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

FKHL13, Forkhead-related protein FKHL13, HFH 4, HFH4, HFH-4

---

Tested Applications

• Positive WB detected in: HeLa cells, Caco-2 cells, T-47D cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86070-1-RR targets FOXJ1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28294

  Product name: Recombinant human FOXJ1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 181-421 aa of BC046460

  Sequence: KVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKGNFDWEAIFDAGTLGGELGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL

• Full Name: forkhead box J1
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC046460
• Gene Symbol: FOXJ1
• Gene ID (NCBI): 2302
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92949
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.