FOXJ2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FOXJ2 Polyclonal antibody, PBS Only (28301-1-PBS)

• 

  WB analysis using 28301-1-AP (same clone as 28301-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28301-1-AP (FOXJ2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28301-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HuH-7 using 28301-1-AP (same clone as 28301-1-PBS)

  WB result of FOXJ2 antibody (28301-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FOXJ2 transfected HuH-7 cells. This data was developed using the same antibody clone with 28301-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FOXJ2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28301-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

FHX

---

Product Information

28301-1-PBS targets FOXJ2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27345

  Product name: Recombinant human FOXJ2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 145-271 aa of BC136305

  Sequence: CPDISRKRRHPPDDDLSQDSPEQEASKSPRGGVAGSGEASLPPEGNPQMSLQSPTSIASYSQGTGSVDGGAVAAGASGRESAEGPPPLYNTNHDFKFSYSEINFQDLSWSFRNLYKSMLEKSSSSSQ

• Full Name: forkhead box J2
• Calculated Molecular Weight: 574 aa, 62 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC136305
• Gene Symbol: FOXJ2
• Gene ID (NCBI): 55810
• RRID: AB_3669651
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0K8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fork head box J2 (FOXJ2) is a transcription factor discovered in mammals and other vertebrates in 2000, which belongs to the Fork head box (Fox) transcription factor family, which shares a conserved DNA-binding domain, known as Fork Head. FOXJ2 participates in the regulation of cell proliferation, differentiation, and migration by targeting downstream genes through its DNA binding domain, and plays fundamental roles in embryonic development, tumorigenesis, and the progression of certain cancers. The expression patterns of FOXJ2 have been reported to be aberrant in a variety of cancers, including breast cancer, extra-hepatic cholangiocarcinoma, nasopharyngeal carcinoma, glioma, and non-small cell lung cancer (PMID: 28769576, PMID: 33725831, PMID: 35908066). This antibody has been validated for knockdown.