FOXK1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86452-1-RR (same clone as 86452-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86452-1-RR (FOXK1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86452-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 86452-1-RR (same clone as 86452-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 86452-1-RR (FOXK1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86452-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 86452-1-RR (same clone as 86452-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using FOXK1 antibody (86452-1-RR, Clone: 251186A11 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86452-1-PBS in a different storage buffer formulation.

FOXK1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 86452-1-PBS

Clone No.251186A11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FOXK1L, MNF

---

Product Information

86452-1-PBS targets FOXK1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28820

  Product name: Recombinant human FOXK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of NM_001037165

  Sequence: MAEVGEDSGARALLALRSAPCSPVLCAAAAAAAFPAAAPPPAPAQPQPPPGPPPPPPPPLPPGAIAGAGSSGGSSGVSGDSAVAGAAPALVAAAAASVRQ

• Full Name: forkhead box K1
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: NM_001037165
• Gene Symbol: FOXK1
• Gene ID (NCBI): 221937
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P85037
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Forkhead box (FOX) domains bind DNA and consist of 2 loops connecting beta-sheets that flank an alpha-helix, which is a group of highly conserved transcription factors. Forkhead box k1 (FOXK1) also known as MNF, is a transcription factor that belongs to the forkhead family consisting of the winged-helix DNA-binding domain and the N-terminal and C-terminal transcriptional domains(PMID: 15289879, PMID: 27223064). There are two isoforms of FoxK1: FoxK1-α and FoxK1-β. FoxK1-α (90 kDa) is expressed in committed myoblasts and differentiated myotubes, while FoxK1-β (55 kDa) is expressed mainly in quiescent satellite cells(PMID: 9271401).