Product Information
25399-1-PBS targets FOXN3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21929 Product name: Recombinant human FOXN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC007506 Sequence: MGPVMPPSKKPESSGISVSSGLSQCYGGSGFSKALQEDDDLDFSLPDIRLEEGAMEDEEL Predict reactive species |
| Full Name | forkhead box N3 |
| Calculated Molecular Weight | 490 aa, 54 kDa |
| Observed Molecular Weight | 54 kDa |
| GenBank Accession Number | BC007506 |
| Gene Symbol | FOXN3 |
| Gene ID (NCBI) | 1112 |
| RRID | AB_3085795 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00409 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
As transcriptional regulators, the FOX protein family regulates the development of tissues, embryos as well as carbohydrate and lipid metabolism. Forkhead box N3 (FOXN3), also known as checkpoint suppressor 1 (CHES1), is initially identified from yeast and belongs to the FOX protein family as it contains a conserved FOX DNA binding domain in its N-terminal(PMID: 36450706). FOXN3 had been dysregulated in many types of malignancies including melanoma, osteosarcoma, hepatocellular carcinoma and breast cancer, and its expression level is strongly associated with progression and prognosis of patients(PMID: 31214487).



