FOXS1 Polyclonal antibody

• 

  WB analysis of mouse liver using 16234-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16234-1-AP (FOXS1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 16234-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16234-1-AP (FOXS1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 16234-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 16234-1-AP (FOXS1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 16234-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16234-1-AP (FOXS1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

FOXS1 Polyclonal Antibody for WB, ELISA

Cat No. 16234-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

FKHL18, Forkhead box protein S1, forkhead box S1, Forkhead like 18 protein, FOXS1, FREAC 10, FREAC10

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

16234-1-AP targets FOXS1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8957

  Product name: Recombinant human FOXS1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-330 aa of BC013408

  Sequence: MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE

• Full Name: forkhead box S1
• Calculated Molecular Weight: 330 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC013408
• Gene Symbol: FOXS1
• Gene ID (NCBI): 2307
• RRID: AB_2878234
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43638
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	FASEB J; FOXS1 acts as an oncogene and induces EMT through FAK/PI3K/AKT pathway by upregulating HILPDA in prostate cancer; Authors - Ruimin Ren
human	WB	Int Immunopharmacol; Adipose mesenchymal stem cell-derived extracellular vesicles alleviate renal fibrosis by reducing epithelial-mesenchymal transition via the FOXS1/Wnt/β-catenin signaling pathway; Authors - Jing Sun ; KD Validated