FPR1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FPR1 Polyclonal antibody (26164-1-AP)

• 

  WB analysis using 26164-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26164-1-AP (FPR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26164-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26164-1-AP (FPR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

FPR1 Polyclonal Antibody for WB, ELISA

Cat No. 26164-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

fMet Leu Phe receptor, FMLP, fMLP receptor, formyl peptide receptor 1, FPR

---

Tested Applications

• Positive WB detected in: NCCIT cells, MDA-MB-231 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26164-1-AP targets FPR1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23105

  Product name: Recombinant human FPR1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 140-203 aa of BC005315

  Sequence: SLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGI

• Full Name: formyl peptide receptor 1
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC005315
• Gene Symbol: FPR1
• Gene ID (NCBI): 2357
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21462
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FPR1 is a Gi-coupled innate immune GPCR that detects formylated peptides from bacteria and damaged mitochondria, initiating leukocyte chemotaxis and inflammatory activation. Predominantly expressed in neutrophils and monocytes, FPR1 functions as a frontline danger sensor in host defense. Dysregulated FPR1 signaling contributes to infectious susceptibility, acute inflammatory injury, and tumor-associated immune modulation, underscoring its importance in innate immunity and inflammatory disease.