FRYL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FRYL Polyclonal antibody (24085-1-AP)

• 

  WB analysis using 24085-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24085-1-AP (FRYL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

FRYL Polyclonal Antibody for WB, ELISA

Cat No. 24085-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Protein furry homolog like, KIAA0826, FRY like, AF4P12

---

Tested Applications

• Positive WB detected in: DU 145 cells, HEK-293 cells, HeLa cells, U2OS cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24085-1-AP targets FRYL in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21333

  Product name: Recombinant human FRYL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 2605-2654 aa of BC021803

  Sequence: MPEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDG

• Full Name: FRY-like
• Calculated Molecular Weight: 3013 aa, 340 kDa
• Observed Molecular Weight: 340 kDa
• GenBank Accession Number: BC021803
• Gene Symbol: FRYL
• Gene ID (NCBI): 285527
• RRID: AB_3742103
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O94915
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FRYL, or FRY-like transcription coactivator, is a protein that belongs to the Furry protein family, which is evolutionarily conserved from yeast to humans. FRYL has almost identical functional domains to the well-characterized Fry protein, which is involved in many processes, including cell polarization, regulation of the actin cytoskeleton, and patterning of sensory neuron dendritic fields (PMID: 34386489). FRYL is a prognostic marker in certain cancers, including Kidney renal clear cell carcinoma, Ovary serous cystadenocarcinoma, and Rectum adenocarcinoma, suggesting its potential role in cancer progression.