FSCN3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FSCN3 Polyclonal antibody, PBS Only (13536-1-PBS)

• 

  WB analysis using 13536-1-AP (same clone as 13536-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13536-1-AP (FSCN3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13536-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 13536-1-AP (same clone as 13536-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13536-1-AP (FSCN3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13536-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13536-1-AP (same clone as 13536-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 13536-1-AP (FSCN3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13536-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13536-1-AP (same clone as 13536-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 13536-1-AP (FSCN3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13536-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 13536-1-AP (same clone as 13536-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed PC-3 cells using 13536-1-AP (FSCN3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13536-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 13536-1-AP (same clone as 13536-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using FSCN3 antibody (13536-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 13536-1-PBS in a different storage buffer formulation.

FSCN3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13536-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Fascin 3, Fascin-3, Testis fascin

---

Product Information

13536-1-PBS targets FSCN3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4459

  Product name: Recombinant human FSCN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 142-498 aa of BC035606

  Sequence: LHVHVILYSPIHRCYARADPTMGRIWVDAAVPCLEECGFLLHFRDGCYHLETSTHHFLSHVDRLFSQPSSQTAFHMQVRPGGLVALCDGEGGMLYPQGTHLLLGMGCNPMRGEEWFILQHCPTWVSLRSKTGRFISVIYDGEVRAASERLNRMSLFQFECDSESPTVQLRSANGYYLSQRRHRAVMADGHPLESDTFFRMHWNCGRIILQSCRGRFLGIAPNSLLMANVILPGPNEEFGILFANRSFLVLRGRYGYVGSSSGHDLIQCNQDQPDRIHLLPCRPGIYHFQAQGGSFWSITSFGTFRPWGKFALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWEF

• Full Name: fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotus purpuratus)
• Calculated Molecular Weight: 498 aa, 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC035606
• Gene Symbol: FSCN3
• Gene ID (NCBI): 29999
• RRID: AB_2106517
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQT6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.