FTSJ1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FTSJ1 Polyclonal antibody (11620-1-AP)

FTSJ1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11620-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MRX44, JM23, FtsJ homolog 1 (E. coli), EC:2.1.1.205, CDLIV

• 

  WB analysis of HeLa using 11620-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11620-1-AP (FTSJ1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11620-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11620-1-AP (FTSJ1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 11620-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11620-1-AP (FTSJ1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 11620-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11620-1-AP (FTSJ1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11620-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11620-1-AP (FTSJ1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 11620-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using FTSJ1 antibody (11620-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FTSJ1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, U-87 MG cells
• Positive IHC detected in: human liver tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11620-1-AP targets FTSJ1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2199

  Product name: Recombinant human FTSJ1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-329 aa of BC023584

  Sequence: MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTGLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP

• Full Name: FtsJ homolog 1 (E. coli)
• Calculated Molecular Weight: 329 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC023584
• Gene Symbol: FTSJ1
• Gene ID (NCBI): 24140
• RRID: AB_2877785
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UET6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The FTSJ1 Polyclonal antibody (Cat# 11620-1-AP) has 3 total citations. These appear in Communications Biology, Biomolecules, and bioRxiv. The research fields span tRNA recognition and epitranscriptome biology, comparative testicular transcriptional and translational analysis in hybrid species, and Dengue virus exploitation of host tRNA modifications to promote viral replication.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Commun Biol; Structural insights into tRNA recognition of the human FTSJ1-THADA complex; Authors - Kensuke Ishiguro
	WB	Biomolecules; Comparative Analysis of Testicular Transcriptional and Translational Landscapes in Yak and Cattle-Yak: Implications for Hybrid Male Sterility; Authors - Mengli Cao
human	WB	bioRxiv; Dengue virus exploits the host tRNA epitranscriptome to promote viral replication; Authors - Cheryl Chan