FTSJ2 Polyclonal antibody

• 

  WB analysis of human skeletal muscle using 22556-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 22556-1-AP (FTSJ2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 22556-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 22556-1-AP (FTSJ2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 22556-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 22556-1-AP (FTSJ2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse skeletal muscle using 22556-1-AP

  IP result of anti-FTSJ2 (IP:22556-1-AP, 3ug; Detection:22556-1-AP 1:500) with mouse skeletal muscle tissue lysate 4000ug.

FTSJ2 Polyclonal Antibody for WB, IP, ELISA

Cat No. 22556-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

FJH1, FtsJ homolog 2 (E. coli), FTSJ2, Protein ftsJ homolog 2

---

Tested Applications

• Positive WB detected in: human skeletal muscle tissue, human placenta tissue
• Positive IP detected in: mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22556-1-AP targets FTSJ2 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18410

  Product name: Recombinant human FTSJ2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-246 aa of BC114514

  Sequence: MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQILRPSLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ

• Full Name: FtsJ homolog 2 (E. coli)
• Calculated Molecular Weight: 246 aa, 27 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC114514
• Gene Symbol: FTSJ2
• Gene ID (NCBI): 29960
• RRID: AB_2879122
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9UI43
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Putative ribosomal RNA methyltransferase 2 (FTSJ2), also named as FJH1 or Protein FTSJ homolog 2 is a 246 amino acid protein, which belongs to the methyl-transferase superfamily. FTSJ2 localizes in the nucleus and is widely expressed in in muscle, placenta, and heart. FTSJ2 functions as a nucleolar RNA methyl-transferase involved in eukaryotic RNA processing and modification.