Use Able AI chat for product recommendations

FTSJD2 Recombinant monoclonal antibody, PBS Only

FTSJD2 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87843-1-PBS
Clone No.253381G2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Cap methyltransferase 1, Cap1 2'O-ribose methyltransferase 1, Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1, CMTR1, EC:2.1.1.57

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87843-1-PBS targets FTSJD2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag26722

Product name: Recombinant human FTSJD2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 499-835 aa of BC031890

Sequence: SNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKSKFFELIQGTEIDIFSYKPTLLTSKTLEKIRPVFDYRCMVSGSEQKFLIGLGKSQIYTWDGRQSDRWIKLDLKTELPRDTLLSVEIVHELKGEGKAQRKISAIHILDVLVLNGTDVREQHFNQRIQLAEKFVKAVSKPSRPDMNPIRVKEVYRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNEPWTMGFSKSFKKKFFYNKKTKDSTFDLPADSIAPFHICYYGRLFWEWGDGIRVHDSQKPQDQDKLSKEDVLSFIQMHRA

Predict reactive species
Full Name FtsJ methyltransferase domain containing 2
Calculated Molecular Weight 835 aa, 95 kDa
Observed Molecular Weight 96-100 kDa
GenBank Accession NumberBC031890
Gene Symbol FTSJD2
Gene ID (NCBI) 23070
RRIDAB_3745783
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N1G2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Cap1 2′-O-methylation is catalyzed by cap methyltransferase 1 (CMTR1). CMTR1, also called IFN-stimulated gene 95 kDa protein (ISG95) or FTSJD2, is elevated by a viral infection and required to promote IFN-mediated induction of ISGs and the antiviral response. High CMTR1 expression is associated with poor prognosis in patients with CRC (PMID: 37024465). CMTr1 binds ATP-dependent RNA DHX15 helicase and that this interaction, mediated by the G-patch domain of CMTr1, has an advantageous effect on CMTr1 activity towards highly structured RNA substrates (PMID: 30397098).). Human CMTR1 is a 95 kDa nuclear protein that has multiple domains, consisting of a G-patch domain, a RrmJ/FtsJ methyltransferase domain, a non-functional cap guanylyltransferase-like domain and a WW domain (PMID: 30312682).

Loading...
||
New chat

Able

正在加载,请稍候...