Tested Applications
| Positive WB detected in | SH-SY5Y cells, Jurkat cells, K-562 cells, mouse brain tissue |
| Positive IP detected in | SH-SY5Y cells |
| Positive IHC detected in | human bladder tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24864-1-AP targets FUBP1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13149 Product name: Recombinant human FUBP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 303-653 aa of BC017247 Sequence: DAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSVQAGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGPPGPPGPGTPMGPYNPAPYNPGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPAKAGTDPNSAAWAAYYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQCRFDPASIELAL Predict reactive species |
| Full Name | far upstream element (FUSE) binding protein 1 |
| Calculated Molecular Weight | 653 aa, 69 kDa |
| Observed Molecular Weight | 69 kDa |
| GenBank Accession Number | BC017247 |
| Gene Symbol | FUBP1 |
| Gene ID (NCBI) | 8880 |
| RRID | AB_2879762 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96AE4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FUBP1 also termed as FBP and FUSE-binding protein 1 is 644 amino-acid protein, which localizes in the nucleus. FUBP1 binds to a single-stranded far-upstream element (FUSE) upstream of the MYC promoter and regulates the MYC expression, indicating that FBP1 functions as a growth-dependent regulator of c-Myc expression. FUBP1 binds to FUSE, and PUF60, and forms a stable tripartite complex, which represses activated but not basal c-myc transcription after transcription initiation by delaying promoter escape. FUBP1 may be acting both as activator and repressor of transcription.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FUBP1 antibody 24864-1-AP | Download protocol |
| IHC protocol for FUBP1 antibody 24864-1-AP | Download protocol |
| IP protocol for FUBP1 antibody 24864-1-AP | Download protocol |
| WB protocol for FUBP1 antibody 24864-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FUBP1 Polyclonal antibody (Cat# 24864-1-AP) has 13 citations across journals including J Adv Res, Adv Sci, MedComm, Sci Adv, Int J Biol Sci, J Immunother Cancer, Biology, J Virol, Discov Oncol, Virology, Anticancer Res, bioRxiv, and Pharmacol Res. Research fields span atherosclerosis, intestinal epithelium homeostasis, osteosarcoma, ALS, renal cell carcinoma, tumor microenvironment remodeling, RNA biology, virology, colorectal cancer, nasopharyngeal carcinoma, and ferroptosis.
| Species | Application | Title |
|---|---|---|
J Adv Res LncRNA NIPA1-SO confers atherosclerotic protection by suppressing the transmembrane protein NIPA1 | ||
MedComm (2020) Far upstream element-binding protein 1 confers lobaplatin resistance by transcriptionally activating PTGES and facilitating the arachidonic acid metabolic pathway in osteosarcoma | ||
Adv Sci (Weinh) PRMT5 Maintains Homeostasis of the Intestinal Epithelium by Modulating Cell Proliferation and Survival | ||
Sci Adv M6A-dependent RNA condensation underlies FUS autoregulation and can be harnessed for ALS therapy development | ||
Int J Biol Sci Poly(U) binding splicing factor 60 promotes renal cell carcinoma growth by transcriptionally upregulating telomerase reverse transcriptase. | ||
J Immunother Cancer The NR_109/FUBP1/c-Myc axis regulates TAM polarization and remodels the tumor microenvironment to promote cancer development
|
Reviews
What customers say
The single review reports a 5-star rating for this antibody used in immunofluorescence on HeLa (human) cells. The user applied it at a 1:1000 dilution in 5% goat serum in PBST with a 2-hour room-temperature incubation, and observed clean nuclear staining. Overall, the feedback is positive, highlighting reliable performance and crisp, specific nuclear localization in ICC applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tatyana (Verified Customer) (12-22-2024) | ICC with antibody diluted in 5% goat serum in PBST, with 2 h incubation at RT. Clean nuclear staining.
 |
