FUCA2 Polyclonal antibody

• 

  WB analysis using 30080-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 30080-1-AP (FUCA2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 30080-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 30080-1-AP (FUCA2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 30080-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using FUCA2 antibody (30080-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

FUCA2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30080-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Alpha-L-fucosidase 2, Alpha-L-fucoside fucohydrolase 2, EC:3.2.1.51, Plasma alpha-L-fucosidase, PSEC0151

---

Tested Applications

• Positive WB detected in: SGC-7901 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30080-1-AP targets FUCA2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32467

  Product name: Recombinant human FUCA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-467 aa of BC003060

  Sequence: ESPVRGTVVTNDRWGAGSICKHGGFYTCSDRYNPGHLLPHKWENCMTIDKLSWGYRREAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFEERLRQVGSWLKVNGEAIYETYTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTSGQLFLGHPKAILGATEVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPCKWGWALALTNVI

• Full Name: fucosidase, alpha-L- 2, plasma
• Calculated Molecular Weight: 54 kDa
• Observed Molecular Weight: 54-60 kDa
• GenBank Accession Number: BC003060
• Gene Symbol: FUCA2
• Gene ID (NCBI): 2519
• RRID: AB_3086225
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BTY2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Alpha-L-fucosidase 2 (FUCA2) is a gene that codes for a secreted non-lysosomal enzyme and belongs to the glycosyl hydrolase 29 (GH29) family. The enzyme is responsible for the removal of the alpha-1,6-fucose linked to N-acetylglucosamine residue of glycoproteins. Serum FUCA2 is a potential biomarker used for early detection of esophageal squamous cell carcinoma (ESCC) and hepatocellular carcinoma (HCC). FUCA2 has 2 isoforms with the molecular mass of 20 and 54 kDa (PMID: 34935631). Sometimes higher molecular weight around 60 kDa can also be observed, which may be a modified variant of FUCA2.