FUNDC2 Polyclonal antibody

FUNDC2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 19832-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

HCC 3, HCBP6, FUN14 domain-containing protein 2, FUN14 domain containing 2, DC44

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HuH-7 cells, HepG2 cells
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19832-1-AP targets FUNDC2 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13800

Product name: Recombinant human FUNDC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-70 aa of BC000255

Sequence: METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLF

Predict reactive species
Full Name FUN14 domain containing 2
Calculated Molecular Weight 189 aa, 21 kDa
Observed Molecular Weight21 kDa
GenBank Accession NumberBC000255
Gene Symbol FUNDC2
Gene ID (NCBI) 65991
RRIDAB_3085587
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BWH2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FUNDC2, or FUN14 domain-containing protein 2, is a mitochondrial outer membrane protein that plays a significant role in various cellular processes, including the regulation of cell survival, apoptosis, and metabolism. It has been implicated in the progression of several types of cancer, particularly in triple-negative breast cancer (TNBC) and liver cancer. In the context of cancer, FUNDC2 has been shown to promote tumorigenesis. It is associated with poor prognosis in hepatocellular carcinoma (HCC) and is involved in mitochondrial fragmentation by inhibiting MFN1-mediated mitochondrial fusion, which can lead to changes in cellular metabolism and energy levels. FUNDC2 also plays a role in platelet function and survival. It binds directly to phosphatidylinositol-3,4,5-trisphosphate (PIP3), which is a key lipid second messenger in cell signaling, and this interaction is crucial for the recruitment of PIP3 to mitochondria. FUNDC2 deficiency has been shown to decrease platelet aggregation and impair hemostasis in mice, highlighting its importance in platelet function.

Protocols

Product Specific Protocols
IHC protocol for FUNDC2 antibody 19832-1-APDownload protocol
WB protocol for FUNDC2 antibody 19832-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...