FUS/TLS Recombinant monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• FUS/TLS Recombinant monoclonal antibody, PBS Only (Capture) (87839-3-PBS)

FUS/TLS Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 87839-3-PBS

Clone No.253392F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

• 

  Sandwich ELISA sample test of MP03406-1

  The mean FUS/TLS concentration was determined to be 1.4 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load, 1.3 ng/mL in HeLa cell extract based on a 1.2 mg/mL extract load, 1.6 ng/mL in HEK-293 cell extract based on a 1.5 mg/mL extract load and 1.4 ng/mL in COS-7 cell extract based on a 3.2 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP03406-1

  Sandwich ELISA standard curve of MP03406-1, Human FUS/TLS Recombinant Matched Antibody Pair - PBS only. 87839-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag2150. 87839-2-PBS was HRP conjugated as the detection antibody. Range: 156-5000 pg/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87839-3-PBS targets FUS/TLS as part of a matched antibody pair:

MP03406-1: 87839-3-PBS capture and 87839-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2150

  Product name: Recombinant human FUS/TLS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 53-400 aa of BC026062

  Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG

• Full Name: fusion (involved in t(12;16) in malignant liposarcoma)
• Calculated Molecular Weight: 75 kDa
• GenBank Accession Number: BC026062
• Gene Symbol: FUS/TLS
• Gene ID (NCBI): 2521
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35637
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.