Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

FUSIP1/SRS10 Polyclonal antibody

FUSIP1/SRS10 Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

FUSIP1, 40 kDa SR-repressor protein, FUS-interacting serine-arginine-rich protein 1, FUSIP2, NSSR

Formulation:  PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for FUSIP1/SRS10 in ?

Tested Applications

Positive WB detected inHepG2 cells, HeLa cells
Positive IHC detected inhuman urothelial carcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10131-1-AP targets FUSIP1/SRS10 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0176

Product name: Recombinant human FUSIP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 9-183 aa of BC001107

Sequence: NTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI

Predict reactive species
Full Name FUS interacting protein (serine/arginine-rich) 1
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC001107
Gene Symbol FUSIP1
Gene ID (NCBI) 10772
RRIDAB_2877726
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75494
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FUSIP1, also named as SRS10, or TASR, is a 262 amino acid protein, which belongs to the splicing factor SR family. FUSIP1 as a Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. FUSIP1 is required for splicing repression in M-phase cells and after heat shock and also acts as a splicing factor that specifically promotes exon skipping during alternative splicing. FUSIP1 Interacting with YTHDC1, a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A)-containing RNAs, prevents SRSF10 from binding to its mRNA-binding sites close to m6A-containing regions, leading to inhibit exon skipping during alternative splicing.

Publications

What published studies show

The FUSIP1/SRS10 Polyclonal antibody (Cat# 10131-1-AP) has 4 citations published in Nature Communications, Molecular Cell, Journal of Experimental & Clinical Cancer Research, and Proteomics Clinical Applications. The research spans splicing regulation in tumor growth, DNA replication stress and PARP inhibitor resistance in prostate cancer, circRNA-mediated glioma angiogenesis, and noninvasive diagnostic markers for bladder cancer. All citations used human samples with WB as the primary application.

SpeciesApplicationTitle
humanWB

Nat Commun

Mutually exclusive acetylation and ubiquitylation of the splicing factor SRSF5 control tumor growth.

Authors - Yuhan Chen
humanWB

Mol Cell

Isoform-specific function of NSD3 in DNA replication stress confers resistance to PARP inhibitors in prostate cancer.

Authors - Shouhai Zhu
humanWB

J Exp Clin Cancer Res

SRSF10 inhibits biogenesis of circ-ATXN1 to regulate glioma angiogenesis via miR-526b-3p/MMP2 pathway.

Authors - Xiaobai Liu
  • KD Validated
humanWB,IHC

Proteomics Clin Appl

Integration of the cancer cell secretome and transcriptome reveals potential noninvasive diagnostic markers for bladder cancer

Authors - Yi-Ting Chen
Loading...
||
New chat

Able™

正在加载,请稍候...