FUT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FUT1 Polyclonal antibody (17956-1-AP)

• Featured Product
• KD/KO Validated

FUT1 Polyclonal Antibody for WB, ELISA

Cat No. 17956-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

Alpha(1,2)FT 1, Fucosyltransferase 1, FUT1, HH, HSC

• 

  WB analysis of mouse liver using 17956-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 17956-1-AP (FUT1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 17956-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 17956-1-AP (FUT1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FUT1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17956-1-AP targets FUT1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12450

  Product name: Recombinant human FUT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 72-365 aa of BC074732

  Sequence: QHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP

• Full Name: fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
• Calculated Molecular Weight: 365 aa, 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC074732
• Gene Symbol: FUT1
• Gene ID (NCBI): 2523
• RRID: AB_2878472
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19526
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Anti-FUT1 (Cat# 17956-1-AP) has 10 citations published in journals including J Nanobiotechnology, Int J Biol Sci, EBioMedicine, Mol Med, Front Immunol, J Agric Food Chem, BBA Mol Basis Dis, Transplantation, J Inflamm Res, and J Cancer Res Clin Oncol. Research fields span allergic rhinitis, hepatocellular carcinoma drug resistance, endometrial decidualization, renal fibrosis, atopic dermatitis, intestinal mucin glycosylation, psoriasis, skin transplantation, colon adenocarcinoma, and gastric cancer.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Nanobiotechnology; New insights into allergic rhinitis treatment: MSC nanovesicles targeting dendritic cells; Authors - Jianyu Liu
human, mouse	WB,IHC	Int J Biol Sci; Lysophosphatidic acid-induced Arf6-driven macropinocytosis of CD147(+) extracellular vesicles promotes sorafenib resistance of hepatocellular carcinoma.; Authors - Luomeng Qian ; KD Validated
human	WB,IHC,IF	EBioMedicine; poFUT1 promotes endometrial decidualization by enhancing the O-fucosylation of Notch1.; Authors - Yu Yang ; KD Validated
human,mouse	WB	Mol Med; FUT1-mediated terminal fucosylation acts as a new target to attenuate renal fibrosis; Authors - Jialiang Luo
human	IF	Front Immunol; Impact of fucosyltransferase 1-mediated epidermal blood group antigen H on anti-inflammatory response in atopic dermatitis; Authors - Na Li
mouse	WB	J Agric Food Chem; Bifidobacterium bifidum Alleviate Intestinal Barrier Damage by Regulating the Intestinal Flora and Colonic Mucin O-Glycan Structural Patterns.; Authors - Meng-Meng Niu