FUT11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FUT11 Polyclonal antibody, PBS Only (17175-1-PBS)

• 

  WB analysis using 17175-1-AP (same clone as 17175-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17175-1-AP (FUT11 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17175-1-AP (same clone as 17175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 17175-1-AP (FUT11 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17175-1-AP (same clone as 17175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 17175-1-AP (FUT11 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 17175-1-AP (same clone as 17175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 17175-1-AP (FUT11 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 17175-1-AP (same clone as 17175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 17175-1-AP (FUT11 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 17175-1-AP (same clone as 17175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 17175-1-AP (FUT11 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 17175-1-AP (same clone as 17175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 17175-1-AP (FUT11 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 17175-1-AP (same clone as 17175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 17175-1-AP (FUT11 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 17175-1-AP (same clone as 17175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 17175-1-AP (FUT11 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 17175-1-AP (same clone as 17175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 17175-1-AP (FUT11 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 17175-1-AP (same clone as 17175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 17175-1-AP (FUT11 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 17175-1-AP (same clone as 17175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 17175-1-AP (FUT11 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 17175-1-AP (same clone as 17175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 17175-1-AP (FUT11 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 17175-1-AP (same clone as 17175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 17175-1-AP (FUT11 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 17175-1-AP (same clone as 17175-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 17175-1-AP (FUT11 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17175-1-PBS in a different storage buffer formulation.

FUT11 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17175-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Alpha-(1,3)-fucosyltransferase 11, EC:2.4.1.-, Fuc TXI, FucT XI, FucTXI

---

Product Information

17175-1-PBS targets FUT11 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10815

  Product name: Recombinant human FUT11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 143-492 aa of BC036037

  Sequence: ALLHEESPLNNFLLSHGPGIRLFNLTSTFSRHSDYPLSLQWLPGTAYLRRPVPPPMERAEWRRRGYAPLLYLQSHCDVPADRDRYVRELMRHIPVDSYGKCLQNRELPTARLQDTATATTEDPELLAFLSRYKFHLALENAICNDYMTEKLWRPMHLGAVPVYRGSPSVRDWMPNNHSVILIDDFESPQKLAEFIDFLDKNDEEYMKYLAYKQPGGITNQFLLDSLKHREWGVNDPLLPNYLNGFECFVCDYELARLDAEKAHAASPGDSPVFEPHIAQPSHMDCPVPTPGFGNVEEIPENDSWKEMWLQDYWQGLDQGEALTAMIHNNETEQTKFWDYLHEIFMKRQHL

• Full Name: fucosyltransferase 11 (alpha (1,3) fucosyltransferase)
• Calculated Molecular Weight: 492 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC036037
• Gene Symbol: FUT11
• Gene ID (NCBI): 170384
• RRID: AB_2231850
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q495W5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.