FUT4 Recombinant monoclonal antibody, PBS Only

• 

FUT4 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84825-1-PBS

Clone No.241888C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase, Alpha-(1,3)-fucosyltransferase 4, EC:2.4.1.152, ELAM-1 ligand fucosyltransferase, ELFT

---

Product Information

84825-1-PBS targets FUT4 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2194

  Product name: Recombinant Human FUT4 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 199-302 aa of BC136374

  Sequence: GGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESPSH

• Full Name: fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific)
• Calculated Molecular Weight: 530 aa, 59 kDa
• GenBank Accession Number: BC136374
• Gene Symbol: FUT4
• Gene ID (NCBI): 2526
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P22083
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.