FUT6 Polyclonal antibody

• 

  WB analysis of HeLa using 16567-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16567-1-AP (FUT6 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16567-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16567-1-AP (FUT6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 16567-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 16567-1-AP (FUT6 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

FUT6 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 16567-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Alpha (1,3) fucosyltransferase, FCT3A, FT1A, Fuc TVI, Fucosyltransferase 6, Fucosyltransferase VI, FucT VI, FUT6

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

16567-1-AP targets FUT6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9847

  Product name: Recombinant human FUT6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-359 aa of BC061700

  Sequence: VSQDDPTVYPNGSRFPDSTGTPAHSIPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSSRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFKNSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT

• Full Name: fucosyltransferase 6 (alpha (1,3) fucosyltransferase)
• Calculated Molecular Weight: 359 aa, 42 kDa
• Observed Molecular Weight: 45-47 kDa
• GenBank Accession Number: BC061700
• Gene Symbol: FUT6
• Gene ID (NCBI): 2528
• RRID: AB_2105683
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51993
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF	IUBMB Life; MicroRNA-106b targets FUT6 to promote cell migration, invasion, and proliferation in human breast cancer.; Authors - Nana Li ; KD Validated
human	WB	Biochim Biophys Acta Mol Cell Res; HOTAIR/miR-326/FUT6 axis facilitates colorectal cancer progression through regulating fucosylation of CD44 via PI3K/AKT/mTOR pathway.; Authors - Shimeng Pan
human	WB,IHC	Transl Oncol; A functional variant rs10409772 in FUT6 promoter regulates colorectal cancer progression through PKA/CREB signaling; Authors - Jie Zhang