FXN Monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP50628-1

  Sandwich ELISA standard curve of MP50628-1, Human FXN Monoclonal Matched Antibody Pair - PBS only. 68925-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag6632. 68925-3-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL

• 

  Sample test of MP50628-1

  The mean FXN concentration was determined to be 246.06 ng/mL in HL-60 cell extract based on a 1.4 mg/mL extract load, 46.90 ng/mL in MCF-7 cell extract based on a 1.2 mg/mL extract load and 476.28 ng/mL in HepG2 cell extract based on a 1.0 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP50628-1

  Cytometric bead array standard curve of MP50628-1, FXN Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68925-2-PBS. Detection antibody: 68925-3-PBS. Standard:Ag6632. Range: 0.098-100 ng/mL.

FXN Monoclonal Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 68925-3-PBS

Clone No.4B5D3

Host / Isotype

Mouse / Ig2b

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Extramitochondrial frataxin, EC:1.16.3.1, dFXN, d FXN, CyaY

---

Product Information

68925-3-PBS targets FXN as part of a matched antibody pair:

MP50628-1: 68925-2-PBS capture and 68925-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / Ig2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6632

  Product name: Recombinant human FXN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-210 aa of BC048097

  Sequence: MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

• Full Name: frataxin
• Calculated Molecular Weight: 23 kDa
• GenBank Accession Number: BC048097
• Gene Symbol: FXN
• Gene ID (NCBI): 2395
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A Magarose purification
• UNIPROT ID: Q16595
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.