FZD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FZD1 Polyclonal antibody (28326-1-AP)

FZD1 Polyclonal Antibody for WB, ELISA

Cat No. 28326-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Frizzled 1, Frizzled-1, Fz 1, Fz-1, FzE1

• 

  WB analysis using 28326-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28326-1-AP (FZD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HL-60 cells, NCI-H1299 cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28326-1-AP targets FZD1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28500

  Product name: Recombinant human FZD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 210-322 aa of BC051271

  Sequence: PDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTW

• Full Name: frizzled homolog 1 (Drosophila)
• Calculated Molecular Weight: 647 aa, 71 kDa
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: BC051271
• Gene Symbol: FZD1
• Gene ID (NCBI): 8321
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UP38
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Frizzled-1 (FZD1) is a member of the Frizzled family of transmembrane receptors, which belongs to the class F of G protein-coupled receptors (GPCRs). In mammals, this family consists of ten isoforms (FZD1-10) (PMID: 38594145). It functions as a receptor for Wnt proteins, a family of secreted lipoglycoproteins. FZD1 is activated by specific Wnt ligands such as WNT3A, WNT3, and WNT1, but not by others like WNT4, WNT5A, or WNT7A. FZD1 regulates specific stages of adult hippocampal neurogenesis, being required for neuronal differentiation and positioning of newborn neurons into the granule cell layer, but not for morphological development of adult-born granule neurons (PMID: 26980182).