Tested Applications
| Positive WB detected in | HEK-293T cells, HL-60 cells, NCI-H1299 cells, U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28326-1-AP targets FZD1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28500 Product name: Recombinant human FZD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 210-322 aa of BC051271 Sequence: PDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTW Predict reactive species |
| Full Name | frizzled homolog 1 (Drosophila) |
| Calculated Molecular Weight | 647 aa, 71 kDa |
| Observed Molecular Weight | 71 kDa |
| GenBank Accession Number | BC051271 |
| Gene Symbol | FZD1 |
| Gene ID (NCBI) | 8321 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UP38 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Frizzled-1 (FZD1) is a member of the Frizzled family of transmembrane receptors, which belongs to the class F of G protein-coupled receptors (GPCRs). In mammals, this family consists of ten isoforms (FZD1-10) (PMID: 38594145). It functions as a receptor for Wnt proteins, a family of secreted lipoglycoproteins. FZD1 is activated by specific Wnt ligands such as WNT3A, WNT3, and WNT1, but not by others like WNT4, WNT5A, or WNT7A. FZD1 regulates specific stages of adult hippocampal neurogenesis, being required for neuronal differentiation and positioning of newborn neurons into the granule cell layer, but not for morphological development of adult-born granule neurons (PMID: 26980182).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for FZD1 antibody 28326-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

