Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, COLO 320 cells, Jurkat cells, PC-3 cells, mouse lung tissue, PC-12 cells, mouse colon tissue, mouse small intestine tissue, rat colon tissue |
| Positive IHC detected in | human stomach cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IHC | See 1 publications below |
Product Information
21519-1-AP targets Frizzled 5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16082 Product name: Recombinant human FZD5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 524-585 aa of BC114346 Sequence: GKTVESWRRFTSRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSHV Predict reactive species |
| Full Name | frizzled homolog 5 (Drosophila) |
| Calculated Molecular Weight | 585 aa, 65 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC114346 |
| Gene Symbol | FZD5 |
| Gene ID (NCBI) | 7855 |
| RRID | AB_2878877 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13467 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Fzd5, is the receptor for the Wnt5A ligand. Fzd5 modulates cell fate and cell behavior during vertebrate development. It regulates hematopoiesis by the antagonism of the canonical Wnt pathway, resulting in a pool of quiescent hematopoietic stem cells, and regulates hematopoietic stem cell function in a paracrine fashion through several distinct mechanisms including modulating canonical Wnt signaling. It acts through noncanonical Wnt signaling to promote angiogenesis. It is also involved in control cell orientation, polarity, and directional movement in response to positional cues from chemokine gradients.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Frizzled 5 antibody 21519-1-AP | Download protocol |
| IHC protocol for Frizzled 5 antibody 21519-1-AP | Download protocol |
| WB protocol for Frizzled 5 antibody 21519-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Discov Cholesterol activates the Wnt/PCP-YAP signaling in SOAT1-targeted treatment of colon cancer.
| ||
Theranostics Alkaline Phosphatase Controls Lineage Switching of Mesenchymal Stem Cells by Regulating the LRP6/GSK3β Complex in Hypophosphatasia. | ||
Mar Drugs Orally Administered Rhamnan Sulfate from Monostroma nitidum Significantly Inhibits Melanoma Metastasis in Lungs and Aorta of Mice Implanted with B16 Cells. | ||
Free Radic Biol Med ZNF831-YTHDF1-DNMT1/3a feedback loop regulates lung carcinogenesis and progression through WNT7B-FZD5-β-catenin signalling axis | ||
Autophagy Autocrine SFRP2 (secreted frizzled related protein 2) enhances lung myofibroblast fibrogenic activity by suppressing PINK1-mediated mitophagy initiation. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Susanne (Verified Customer) (04-17-2023) |
![]() |
FH Louisiane (Verified Customer) (08-11-2022) | PFA fixed tissues (small intestine sections) were incubated over the weekend at 4C with primary antibody and overnight at 4C with secondary antibody. No signal detected in the small intestine.
|














