• Featured Product
  • KD/KO Validated

Frizzled 7 Polyclonal antibody

Frizzled 7 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 16974-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, CoIP, RIP, ELISA

Frizzled 7, Fz 7, FZD7, FzE3, hFz7

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse skeletal muscle tissue, mouse heart tissue, mouse kidney tissue
Positive IP detected inmouse skeletal muscle tissue
Positive IHC detected inhuman small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16974-1-AP targets Frizzled 7 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9446

Product name: Recombinant human FZD7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 33-257 aa of BC015915

Sequence: QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWV

Predict reactive species
Full Name frizzled homolog 7 (Drosophila)
Calculated Molecular Weight 574 aa, 64 kDa
Observed Molecular Weight 64 kDa
GenBank Accession NumberBC015915
Gene Symbol Frizzled 7
Gene ID (NCBI) 8324
RRIDAB_2294535
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75084
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Frizzled class receptor 7 (Frizzled 7, also known as FZD7) is a member of the superfamily of G protein-coupled receptor proteins that act as receptors in the Wnt signaling pathway. Frizzled 7 plays a role in development, stem cell renewal, and differentiation and has been implicated in the progression of various cancers.

What is the molecular weight of Frizzled 7? Is Frizzled 7 post-translationally modified?

The molecular size of Frizzled 7 is ~63 kDa, which represents the mature N-glycosylated species (PMID: 25274627). Frizzled 7 can form homodimers and heterodimers with other Frizzled family members (PMID: 14688793).

What is the subcellular localization of Frizzled 7?

Frizzled 7 is a seven-pass transmembrane protein that is present at the plasma membrane. In endothelial cells, it predominantly locates to cell-cell junctions (PMID: 24866384). Frizzled 7 has a cleavage site for calpain-1 protease in its C-terminus that regulates its activity and plasma membrane turnover (PMID: 17716656).

What is the tissue expression pattern of Frizzled 7?

Frizzled 7 is expressed at high levels in adult skeletal muscles and in fetal kidneys, but is also present in fetal lung, adult heart, brain, and placenta (PMID: 9813155). Frizzled 7 expression is increased in various cancer types, including melanoma, hepatocellular carcinoma, lung, esophageal, gastric, and colon cancers.


Protocols

Product Specific Protocols
WB protocol for Frizzled 7 antibody 16974-1-APDownload protocol
IHC protocol for Frizzled 7 antibody 16974-1-APDownload protocol
IP protocol for Frizzled 7 antibody 16974-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseWB,IHC

Adv Mater

m6 A Reader YTHDF1-Targeting Engineered Small Extracellular Vesicles for Gastric Cancer Therapy via Epigenetic and Immune Regulation

Authors - Qing You
humanCoIP

Cell Death Differ

Cripto-1 contributes to stemness in hepatocellular carcinoma by stabilizing Dishevelled-3 and activating Wnt/β-catenin pathway.

Authors - Regina Cheuk-Lam Lo
humanWB

Mol Syst Biol

Systematic protein-protein interaction mapping for clinically relevant human GPCRs.

Authors - Kate Sokolina
humanWB

Cancer Res

YTHDF1 promotes gastric carcinogenesis by controlling translation of FZD7.

Authors - Jingnan Pi
mouseWB,IF,RIP

Arch Med Res

RNA-binding Protein QKI Inhibits Osteogenic Differentiation Via Suppressing Wnt Pathway

Authors - Zhao Yan
humanIF

Apoptosis

YTHDF1-mediated m6A modification promotes cisplatin resistance in ovarian cancer via the FZD7/Wnt/β-catenin pathway

Authors - Jintian Miao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Susanne (Verified Customer) (04-17-2023)

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Fibroblasts
Frizzled 7 Antibody Immunofluorescence validation (1:500 dilution) in Fibroblasts (Cat no:16974-1-AP)
FH

Louisiane (Verified Customer) (08-11-2022)

Tissues (small intestine sections) were incubated with primary antibody over the weekend at 4C and with secondary antibody overnight at 4C. The signal looks good

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1 to 100
Loading...
||
New chat Able
正在加载,请稍候...