Frizzled 9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Frizzled 9 Polyclonal antibody (13865-1-AP)

Frizzled 9 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13865-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CD349, Frizzled 9, Fz 9, FZD3, FZD9, FzE6, hFz9

• 

  WB analysis using 13865-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13865-1-AP (Frizzled 9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 13865-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13865-1-AP (Frizzled 9 antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse eye using 13865-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 13865-1-AP (Frizzled 9 antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13865-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13865-1-AP (Frizzled 9 antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HUVEC using 13865-1-AP

  HUVEC cells were subjected to SDS PAGE followed by western blot with 13865-1-AP (Frizzled 9 antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 13865-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13865-1-AP (Frizzled 9 antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 13865-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13865-1-AP (Frizzled 9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 13865-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13865-1-AP (Frizzled 9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 13865-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13865-1-AP (Frizzled 9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 13865-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13865-1-AP (Frizzled 9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Frizzled 9 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse skeletal muscle tissue, mouse testis tissue, mouse brain tissue, mouse eye tissue, HUVEC cells
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13865-1-AP targets Frizzled 9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4847

  Product name: Recombinant human FZD9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-247 aa of BC026333

  Sequence: LEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSGTCENREKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTA

• Full Name: frizzled homolog 9 (Drosophila)
• Calculated Molecular Weight: 591 aa, 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC026333
• Gene Symbol: Frizzled 9
• Gene ID (NCBI): 8326
• RRID: AB_2107358
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00144
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Frizzled 9 (FZD9) polyclonal antibody (Cat# 13865-1-AP) has 3 total citations published in Theranostics, Small, and Frontiers in Oncology. The cited research spans mesenchymal stem cell lineage switching in hypophosphatasia, osteogenic and antioxidative biomaterials for periodontitis treatment, and cancer stem cell regulation in colorectal carcinoma. All citations used the antibody for Western blot applications in human or mouse samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Theranostics; Alkaline Phosphatase Controls Lineage Switching of Mesenchymal Stem Cells by Regulating the LRP6/GSK3β Complex in Hypophosphatasia.; Authors - Wenjia Liu
mouse	WB	Small; Zinc-Cobalt Bimetallic Organic Frameworks with Antioxidative and Osteogenic Activities for Periodontitis Treatment; Authors - Hao Tang
human	WB	Front Oncol; YTHDF1 Regulates Tumorigenicity and Cancer Stem Cell-Like Activity in Human Colorectal Carcinoma.; Authors - Yang Bai