Anti-Rat Fas Ligand/CD178 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of Transfected HEK-293T using 98430-1-RR (same clone as 98430-1-PBS)

  1x10^6 HEK-293T cells or Fas Ligand/TNFSF6 transfected HEK-293T cells were surface stained with 0.25 ug Anti-Rat Fas Ligand/TNFSF6 Rabbit RecAb (98430-1-RR, Clone:242892G9) and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005). Cells were not fixed. This data was developed using the same antibody clone with 98430-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected HEK-293T using 98430-1-RR (same clone as 98430-1-PBS)

  1x10^6 HEK-293T cells or Fas Ligand/TNFSF6 transfected HEK-293T cells were surface stained with 0.25 ug Anti-Rat Fas Ligand/TNFSF6 Rabbit RecAb (98430-1-RR, Clone: 242892G9) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005). Cells were not fixed. This data was developed using the same antibody clone with 98430-1-PBS in a different storage buffer formulation.

Fas Ligand/CD178 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98430-1-PBS

Clone No.242892G9

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC

Synonyms

ADAM10-processed FasL form, APL, Apt1Lg1, CD178, CD95 ligand

---

Product Information

98430-1-PBS targets Fas Ligand/CD178 in FC applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3218

  Product name: Recombinant Rat Fas Ligand/TNFSF6 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 103-278 aa of NM_012908.1

  Sequence: HLQKELAELREFTNHSLRVSSFEKQIANPSTPSETKKPRSVAHLTGNPRSRSIPLEWEDTYGTALISGVKYKKGGLVINEAGLYFVYSKVYFRGQSCNSQPLSHKVYMRNFKYPGDLVLMEEKKLNYCTTGQIWAHSSYLGAVFNLTVADHLYVNISQLSLINFEESKTFFGLYKL

• Full Name: Fas ligand (TNF superfamily, member 6)
• Calculated Molecular Weight: 31 kDa
• GenBank Accession Number: NM_012908.1
• Gene Symbol: Faslg
• Gene ID (NCBI): 25385
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P36940
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD178, also known as Fas ligand, is a type II transmembrane protein that belongs to the tumor necrosis factor (TNF) family. It is expressed on NK cells, cytotoxic T lymphocytes and activated CD4+ Th1 cells. CD178 transduces apoptotic signal into cells by binding to FAS/CD95. It is involved as a death factor in the regulation of activation-induced cell death, establishment of immune privilege and tumor cell survival.