Fas/CD95 Recombinant monoclonal antibody, PBS Only

• 

Fas/CD95 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83400-1-PBS

Clone No.240340B6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

FAS, ALPS1A, APO-1, Apo-1 antigen, Apoptosis-mediating surface antigen FAS

---

Product Information

83400-1-PBS targets Fas/CD95 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0877

  Product name: Recombinant Human Fas/CD95 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 26-173 aa of NM_000043.6

  Sequence: QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN

• Full Name: Fas (TNF receptor superfamily, member 6)
• Calculated Molecular Weight: 38 kDa
• GenBank Accession Number: NM_000043.6
• Gene Symbol: Fas/CD95
• Gene ID (NCBI): 355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P25445-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.