Fetuin-A/AHSG Recombinant monoclonal antibody, PBS Only

Fetuin-A/AHSG Recombinant Antibody for WB, Indirect ELISA
Cat No. 80793-1-PBS
Clone No.1E4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

AHSG, Fetuin-A, Alpha 2 Z globulin, alpha 2 HS glycoprotein, AHS

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

80793-1-PBS targets Fetuin-A/AHSG in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9853

Product name: Recombinant human AHSG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-367 aa of BC048198

Sequence: MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

Predict reactive species
Full Name alpha-2-HS-glycoprotein
Calculated Molecular Weight 367 aa, 39 kDa
Observed Molecular Weight58 kDa
GenBank Accession NumberBC048198
Gene Symbol Fetuin-A
Gene ID (NCBI) 197
RRIDAB_2918913
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02765
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Fetuin-A, also named as Alpha2-HS glycoprotein (AHSG), is a member of cystatin superfamily of protease inhibitors. It is a highly expressed glycoprotein in various fetal tissues whereas it is mainly expressed by the liver in adults. Fetuin A, an extracellular inhibitor of transforming growth factor β, is a profibrogenic stimulus in liver disease. Circulating fetuin-A may be a beneficial serum biomarker in the detection of liver and vascular fibrosis progression in patients with non-alcoholic fatty liver disease. It is also involved in several functions, such as endocytosis, brain development and the formation of bone tissue. Fetuin-A exerts its effects on the cardiovascular system by two different mechanisms. On the one hand it inhibits ins signaling and induces ins resistance contributing to the onset of atherosclerosis and on the other hand it inhibits calcium deposition and protects from vascular calcification.

Loading...
||
New chat Able
正在加载,请稍候...