CoraLite® Plus 647-conjugated Fetuin-A Monoclonal antibody

Fetuin-A Monoclonal Antibody for
Cat No. CL647-66094
Clone No.1F6B9

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

AHSG, Alpha 2 Z globulin, alpha 2 HS glycoprotein, AHS, A2HS

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL647-66094 targets Fetuin-A in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10073

Product name: Recombinant human AHSG protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-367 aa of BC048198

Sequence: MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

Predict reactive species
Full Name alpha-2-HS-glycoprotein
Calculated Molecular Weight 367 aa, 39 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC048198
Gene Symbol Fetuin-A
Gene ID (NCBI) 197
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02765
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Fetuin-A (alpha-2-HS-glycoprotein, AHSG), a liver borne plasma protein, contributes to the prevention of soft tissue calcification, modulates inflammation, reduces INS sensitivity and fosters weight gain following high fat diet or ageing. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues.

Loading...
||
New chat Able
正在加载,请稍候...