Ficolin 2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Ficolin 2 Polyclonal antibody, PBS Only (32442-1-PBS)

• 

  WB analysis using 32442-1-AP (same clone as 32442-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32442-1-AP (FCN2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32442-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 32442-1-AP (same clone as 32442-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 32442-1-AP (Ficolin 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32442-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 32442-1-AP (same clone as 32442-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 32442-1-AP (Ficolin 2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32442-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 32442-1-AP (same clone as 32442-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 32442-1-AP (Ficolin 2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32442-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse liver using 32442-1-AP (same clone as 32442-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using Ficolin 2 antibody (32442-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32442-1-PBS in a different storage buffer formulation.

Ficolin 2 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 32442-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

FCN2, FCNL, Ficolin B, Ficolin beta, Hucolin

---

Product Information

32442-1-PBS targets Ficolin 2 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37525

  Product name: Recombinant human FCN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 228-288 aa of NM_004108

  Sequence: EGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFA

• Full Name: ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34-35 kDa
• GenBank Accession Number: NM_004108
• Gene Symbol: FCN2
• Gene ID (NCBI): 2220
• RRID: AB_3742612
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q15485
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ficolins are a group of oligomeric lectins with subunits consisting of both collagen-like and fibrinogen-like domains (PMID: 20375620). They are innate pattern recognition receptors and play integral roles in the immune response. In humans, there are three ficolins termed M-, L-, and H-ficolin (also referred to as ficolin-1, -2, and -3) whereas rodents only possess ficolin-A and -B, which are the orthologues of human L- and M-ficolin, respectively (PMID: 30868077). Ficolin 2 recognizes pathogen-associated pattern molecules (PAMPs) on the surface of pathogenic microorganisms, activates the complement lectin pathway, and binds to mannose-binding lectin-associated serine proteases (MASPs) to exert immune defense function (PMID: 21315829).