Tested Applications
| Positive IHC detected in | human paracancerous of skin squamous cell cancer tissue, human skin squamous cell cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26931-1-AP targets Filaggrin in IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25389 Product name: Recombinant human Filaggrin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of NM_002016 Sequence: MRKENLPISGHKHRKHSHHDKHEDNKQEENKENRKRPSSLERRNNRKGNKGRSKSPRETGGKRHESSSEKKERKGYSPTHREEEYGKNHHNSSKKEKNKTEN Predict reactive species |
| Full Name | filaggrin |
| Calculated Molecular Weight | 435 kDa |
| GenBank Accession Number | NM_002016 |
| Gene Symbol | FLG |
| Gene ID (NCBI) | 2312 |
| RRID | AB_3742205 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20930 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Profilaggrin is a major protein component of the keratohyalin granules of mammalian epidermis. It is initially expressed as a large polyprotein precursor, which is subsequently proteolytically processed into individual functional filaggrin molecules. The free filaggrin binds to keratin intermediate filaments, causing their aggregation into macrofibrils in which the intermediate filaments are aligned in tightly packed parallel arrays. Mutations in Filaggrin are associated with Ichthyosis vulgaris and Dermatitis atopic 2.(PMID: 19386895, 16550169)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Filaggrin antibody 26931-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Cosmet Dermatol Dual-Targeting Oligopeptide-215 Regulates Skin Barrier Homeostasis Through Concurrent Modulation of JAK-STAT and NF-κB Signaling. | ||
Int J Biol Macromol Characterization and development of a gelatin/elastin methacrylamide-based bioink for creating a 3D bioprinted human skin model. | ||
J Allergy Clin Immunol Eosinophilic chronic rhinosinusitis with nasal polyps: Squamous metaplasia as an associated remodeling feature. |







