Filamin A Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Filamin A Recombinant monoclonal antibody (86959-3-RR)

• 

  WB analysis using 86959-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86959-3-RR (FLNA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 86959-3-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Filamin A antibody (86959-3-RR, Clone: 252084C12 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 86959-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86959-3-RR against Human Filamin A were performed. The affinity constant is 6.35 nM.

Filamin A Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86959-3-RR

Clone No.252084C12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

FLNA, ABP-280, Actin-binding protein 280, Alpha filamin, Alpha-filamin

---

Tested Applications

• Positive WB detected in: HepG2 cells, Jurkat cells, MCF-7 cells, NIH/3T3 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86959-3-RR targets Filamin A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1581

  Product name: Recombinant human FLNA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2348-2647 aa of BC014654

  Sequence: NQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP

• Full Name: filamin A, alpha (actin binding protein 280)
• Calculated Molecular Weight: 2647 aa, 280 kDa
• Observed Molecular Weight: 280 kDa
• GenBank Accession Number: BC014654
• Gene Symbol: FLNA
• Gene ID (NCBI): 2316
• RRID: AB_3745235
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21333
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FLNA encodes a 280 kDa widely expressed actin binding protein called filamin A which can crosslinks actin filaments and links actin filaments to membrane glycoproteins to form a three-dimensional network (PMID:29931263). And filamin A could interact with many other proteins, involved in receptor activation, cell migration and adhesion, cell proliferation, inflammation and tumorigenesis, studies have been reported that FLNA overexpressed in multiple types of tumors, suggesting FLNA may involved in cancer aggressiveness(PMID:29100390). What's more, FLNA is an causative gene of periventricular nodular heterotopia (PNH) (PMID: 29062687)