Mouse Foxp3 Recombinant monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Mouse Foxp3 Recombinant monoclonal antibody, PBS Only (Detector) (85128-2-PBS)

• 

  Sandwich ELISA standard curve of MP01845-2

  Sandwich ELISA standard curve of MP01845-2, Mouse Foxp3 Recombinant Matched Antibody Pair - PBS only. 85128-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg4361. 85128-2-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL

• 

  Sample test of MP01845-2

  The mean Foxp3 concentration was determined to be 13.33 ng/mL in mouse spleen tissue extract based on a 8.4 mg/mL extract load, 2.13 ng/mL in NIH/3T3 cell extract based on a 1.5 mg/mL extract load, and 47.11 ng/mL in RAW264.7 cell extract based on a 1.3 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP01845-2

  Cytometric bead array standard curve of MP01845-2, MOUSE Foxp3 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85128-1-PBS. Detection antibody: 85128-2-PBS. Standard: Eg4360. Range: 0.781-100 ng/mL.

Foxp3 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85128-2-PBS

Clone No.242674G3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

forkhead box P3, Forkhead box protein P3 41 kDa form, Forkhead box protein P3, C-terminally processed, JM2, scurfin

---

Product Information

85128-2-PBS targets Foxp3 as part of a matched antibody pair:

MP01845-2: 85128-1-PBS capture and 85128-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4360

  Product name: Recombinant Mouse Foxp3 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 10007378 of

  Sequence: YPLLANGVCKWPGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALAKAPS

• Full Name: forkhead box P3
• Gene Symbol: Foxp3
• Gene ID (NCBI): 20371
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99JB6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.