Frataxin Recombinant monoclonal antibody, PBS Only

Frataxin Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 86195-4-PBS
Clone No.250761C8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

FXN, CyaY, d FXN, dFXN, EC:1.16.3.1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86195-4-PBS targets Frataxin in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg4622

Product name: Recombinant Human Frataxin protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 42-210 aa of NM_000144.5

Sequence: LRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

Predict reactive species
Full Name frataxin
Calculated Molecular Weight23kDa
Observed Molecular Weight 14-23 kDa
GenBank Accession NumberNM_000144.5
Gene Symbol FXN
Gene ID (NCBI) 2395
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16595-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Frataxin (FXN), also named as FRDA, X25, m81-FXN, d-FXN, m78-FXN and i-FXN, belongs to the frataxin family. It promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. FXN may play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. FXN is cleaved to be 4 chains. FXN is expressed in the cytoplasm as a 210 amino acid (AA) precursor protein (pFXN; 23 KDa) that is translocated into mitochondria where it is processed by two consecutive steps into iFXN (FXN 42-210; 19 KDa) and finally mFXN (81-210; 14.2 KDa), which is functional. (PMID: 26704351, PMID: 26671574)

Loading...
||
New chat Able
正在加载,请稍候...