Rat FSTL1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP01756-2

  Serum of sixteen rats was measured. The FSTL1 concentration of detected samples was determined to be 51.0 ng/mL with a range of 27.4-88.9 ng/mL.

• 

  Sandwich ELISA sample test of MP01756-2

  The mean FSTL1 concentration was determined to be 121.8 ng/mL in C6 cell extract based on a 1.2 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP01756-2

  Sandwich ELISA standard curve of MP01756-2, Rat FSTL1 Recombinant Matched Antibody Pair - PBS only. 85034-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg2605. 85034-3-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.

• 

  Cytometric bead array standard curve of MP01756-2

  Cytometric bead array standard curve of MP01756-2, RAT Fstl1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85034-2-PBS. Detection antibody: 85034-3-PBS. Standard: Eg2605. Range: 0.781-100 ng/mL.

FSTL1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 85034-2-PBS

Clone No.242633E3

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

Follistatin-like protein 1, Follistatin-related protein 1, Frp

---

Product Information

85034-2-PBS targets FSTL1 as part of a matched antibody pair:

MP01756-2: 85034-2-PBS capture and 85034-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2605

  Product name: Recombinant Rat FSTL1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 19-306 aa of NM_024369.2

  Sequence: EEEQRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQANRDELRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKSFDNGDSHLDSSEFLKFVEQNETAVNITAYPNQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCSCGHWVCTAMTCDGKNQKGVQTHTEEEMTRYAQELQKHQGTAEKTKKVNTKEI

• Full Name: follistatin-like 1
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: NM_024369.2
• Gene Symbol: Fstl1
• Gene ID (NCBI): 79210
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q62632
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.