Mouse G-CSF Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP00806-2

  Serum of sixteen mice was measured. The G-CSF concentration of detected samples was determined to be 594.3 pg/mL with a range of 189.4-987.2 pg/mL.

• 

  Sandwich ELISA standard curve of MP00806-2

  Sandwich ELISA standard curve of MP00806-2, Mouse G-CSF Recombinant Matched Antibody Pair - PBS only.83826-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg0256.83826-4-PBS was HRP conjugated as the detection antibody. Range: 15.6-1000 pg/mL.

G-CSF Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 83826-3-PBS

Clone No.250727E5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

Csf3, Csfg, G CSF, Granulocyte colony-stimulating factor

---

Product Information

83826-3-PBS targets G-CSF as part of a matched antibody pair:

MP00806-2: 83826-3-PBS capture and 83826-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0256

  Product name: Recombinant Mouse G-CSF protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 31-208 aa of NM_009971

  Sequence: VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

• Full Name: colony stimulating factor 3 (granulocyte)
• Calculated Molecular Weight: 22kd
• GenBank Accession Number: NM_009971
• Gene Symbol: Csf3
• Gene ID (NCBI): 12985
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09920
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.