G6PC3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• G6PC3 Polyclonal antibody (23967-1-AP)

G6PC3 Polyclonal Antibody for IHC, ELISA

Cat No. 23967-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

G 6 Pase 3, G6Pase 3, G6Pase beta, G6PC3, Glucose 6 phosphatase 3, Glucose 6 phosphatase beta, SCN4, UGRP

• 

  IHC staining of human liver using 23967-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 23967-1-AP (G6PC3 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for G6PC3 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23967-1-AP targets G6PC3 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21103

  Product name: Recombinant human G6PC3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 226-346 aa of BC021574

  Sequence: WSISLAFKWCERPEWIHVDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAQLGNGQKIACLVLAMGLLGPLDWLGHPPQISLFYIFNFLKYTLWPCLVLALVPWAVHMFSAQEAPPIHSS

• Full Name: glucose 6 phosphatase, catalytic, 3
• Calculated Molecular Weight: 346 aa, 39 kDa
• GenBank Accession Number: BC021574
• Gene Symbol: G6PC3
• Gene ID (NCBI): 92579
• RRID: AB_2879380
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9BUM1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The G6PC3 Polyclonal antibody (Cat# 23967-1-AP) has 2 citations. These appear in BMC Cancer and Development. The cited research spans cancer biology—specifically lactylation heterogeneity and prognostic targets in glioblastoma—and developmental biology, focusing on intraflagellar transport, Hedgehog signaling, and hair follicle morphogenesis.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		BMC Cancer; Decoding lactylation heterogeneity in glioblastoma: machine learning identifies G6PC3 as a prognostic target.; Authors - Yushu Liu
		Development; Intraflagellar transport 27 is essential for hedgehog signaling but dispensable for ciliogenesis during hair follicle morphogenesis.; Authors - Ning Yang