GABBR2 Polyclonal antibody

• 

GABBR2 Polyclonal Antibody for ELISA

Cat No. 13090-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

G protein coupled receptor 51, GABA B R2, GABA B receptor 2, GABA BR2, GABAB receptor 2, GABABR2, GABBR2, Gb2, GPR51, GPRC3B, HG20, HRIHFB2099

---

Product Information

13090-1-AP targets GABBR2 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3661

  Product name: Recombinant human GABBR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-324 aa of BC035071

  Sequence: MGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRH

• Full Name: gamma-aminobutyric acid (GABA) B receptor, 2
• Calculated Molecular Weight: 941 aa, 106 kDa
• GenBank Accession Number: BC035071
• Gene Symbol: GABBR2
• Gene ID (NCBI): 9568
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75899
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.