GABRA2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GABRA2 Polyclonal antibody, PBS Only (28535-1-PBS)

• 

  WB analysis using 28535-1-AP (same clone as 28535-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28535-1-AP (GABRA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28535-1-PBS in a different storage buffer formulation.

GABRA2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28535-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

GABA(A) receptor subunit alpha-2, GABAAR subunit alpha-2, Gamma-aminobutyric acid receptor subunit alpha-2

---

Product Information

28535-1-PBS targets GABRA2 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29301

  Product name: Recombinant human GABRA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 348-412 aa of NM_000807

  Sequence: SVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFN

• Full Name: gamma-aminobutyric acid (GABA) A receptor, alpha 2
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: NM_000807
• Gene Symbol: GABRA2
• Gene ID (NCBI): 2555
• RRID: AB_3742295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P47869
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GABRA2 (gamma-aminobutyric acid type A receptor subunit alpha2), also known as DEE78. It is expected to be located in cell membrane, and the protein is highly expressed in brain. The protein is a ligand-gated chloride channel, which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain (PubMed:29961870). It also plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel (PubMed:29961870). The calculated molecular weight of GABRA2 is 51 kDa.