GABRA3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GABRA3 Polyclonal antibody, PBS Only (12708-1-PBS)

• 

  WB analysis using 12708-1-AP (same clone as 12708-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12708-1-AP (GABRA3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12708-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 12708-1-AP (same clone as 12708-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 12708-1-AP (GABRA3 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12708-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12708-1-AP (same clone as 12708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12708-1-AP (GABRA3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12708-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12708-1-AP (same clone as 12708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12708-1-AP (GABRA3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12708-1-PBS in a different storage buffer formulation.

GABRA3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12708-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12708-1-PBS targets GABRA3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3389

  Product name: Recombinant human GABRA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-282 aa of BC028629

  Sequence: PGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLPYTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQT

• Full Name: gamma-aminobutyric acid (GABA) A receptor, alpha 3
• Calculated Molecular Weight: 492 aa, 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC028629
• Gene Symbol: GABRA3
• Gene ID (NCBI): 2556
• RRID: AB_10640903
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P34903
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.