GABRB1 Polyclonal antibody, PBS Only

• 

  WB analysis using 28425-1-AP (same clone as 28425-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28425-1-AP (GABRB1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28425-1-PBS in a different storage buffer formulation.

GABRB1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28425-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

28425-1-PBS targets GABRB1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29243

  Product name: Recombinant human GABRB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-243 aa of BC022449

  Sequence: HSTNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLCVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNI

• Full Name: gamma-aminobutyric acid (GABA) A receptor, beta 1
• Calculated Molecular Weight: 474 aa, 54 kDa
• Observed Molecular Weight: 50-54 kDa
• GenBank Accession Number: BC022449
• Gene Symbol: GABRB1
• Gene ID (NCBI): 2560
• RRID: AB_2881139
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P18505
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.