GABRE Polyclonal antibody

• 

GABRE Polyclonal Antibody for ELISA

Cat No. 14107-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

GABA A Receptor Epsilon, GABA Receptor Epsilon, GABAA Receptor Epsilon, GABRE

---

Product Information

14107-1-AP targets GABRE in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5243

  Product name: Recombinant human GABRE protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 28-279 aa of BC059376

  Sequence: KNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEIAVNSLGPLSILDMEYTIDIIFSQTWYDERLCYNDTFESLVLNGNVVSQLWIPDTFFRNSKRTHEHEITMPNQMVRIYKDGKVLYTIRMTIDAGCSLHMLRFPMDSHSCPLSFSSFSYPENEMIYKWENFKLEINEKNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGY

• Full Name: gamma-aminobutyric acid (GABA) A receptor, epsilon
• Calculated Molecular Weight: 365 aa, 42 kDa
• GenBank Accession Number: BC059376
• Gene Symbol: GABRE
• Gene ID (NCBI): 2564
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P78334
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.