GABRP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GABRP Polyclonal antibody (30642-1-AP)

GABRP Polyclonal Antibody for IHC, ELISA

Cat No. 30642-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

GABA A receptor pi, GABA(A) receptor subunit pi, GABAA receptor pi, GABAAR subunit pi, Gamma-aminobutyric acid receptor subunit pi

• 

  IHC staining of human placenta using 30642-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30642-1-AP (GABRP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 30642-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30642-1-AP (GABRP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30642-1-AP targets GABRP in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32653

  Product name: Recombinant human GABRP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 328-416 aa of BC074865

  Sequence: HYSSLQQMAAKDRGTTKEVEEVSITNIINSSISSFKRKISFASIEISSDNVDYSDLTMKTSDKFKFVFREKMGRIVDYFTIQNPSNVDH

• Full Name: gamma-aminobutyric acid (GABA) A receptor, pi
• Calculated Molecular Weight: 440 aa, 51 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC074865
• Gene Symbol: GABRP
• Gene ID (NCBI): 2568
• RRID: AB_3742362
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00591
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Gabrp (gamma-aminobutyric acid type a receptor pi subunit) is a subunit of gamma-aminobutyric acid type A receptor (GABAAR) and belongs to the ligand-gated ion channel superfamily. GABAAR is the main inhibitory neurotransmitter receptor in the central nervous system, which consists of five subunits, usually including the combination of α, β, γ, δ, ε, θ, π or ρ subunits. GABRP belongs to GABAAR gene family. The commonness of this family is that GABA(γ- aminobutyric acid) mediates chloride influx, which leads to hyperpolarization of neurons and thus inhibits nerve excitability. GABRP is mainly expressed in non-nerve tissues, such as uterus, ovary, breast and pancreas, but it is also expressed at a low level in some brain regions. The mutation or abnormal expression of GABRP may be related to diseases, for example, GABRP is often overexpressed in breast cancer, which may promote tumor progression by affecting cell proliferation and migration.